Kinase Browser
Detailed locus information, expression profile, gene disruption strategy, and phenotype assay data.
Detailed Locus Information for CNAG_00810T0
| Species | Cryptococcus neoformans var. grubii H99 | ||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Annotation | polynucleotide kinase 3'-phosphatase | ||||||||||||||||||
| Gene Symbol | Unknown | ||||||||||||||||||
| Kinase Superfamily | P-loop containing nucleoside triphosphate hydrolases | ||||||||||||||||||
| Kinase Family | Nucleotide and nucleoside kinases | ||||||||||||||||||
| KEGG Linkout | KEGG::CNA07870 | ||||||||||||||||||
| Genome Browser | JBrowse link goes here. Sequence information also available from JBrowse. | ||||||||||||||||||
| Kinase Prediction | N/A | ||||||||||||||||||
| Functional Annotation |
|
||||||||||||||||||
| Amino Acid Sequence | MPPQKRTAEWPEPPAKKTHPFFTNEPKEHGKFHPSDPALIHFTHLDPFESLPNPSSGTTNPIASVSSSKKIPVAFYDLDGTLIKTRSGNDFPKSRDDWMWWHPSVPEKLKQEWEDGTHLVVISNQGSKKPKIKSEWRAKLPLIAAKMPNNVPLRILAAIEQNNIYRKPNIGMFQAITEIYRARGLEIDMEKSIFVGDAAGRPAKGSRKKDHGNTDYKFAINVGLRFVTPEEHFLGHPRPSFPDPPIGFRPRNLGIFDILPHIVPSHTPITRKTDTEVEIVIFVGYPASGKSSFFRKHFQPAGYVHVNQDTLRTREKCLNVAEQAVKGGKSVVIDNTNRNRETRAYWVALASKLNVPIRLFHFLCPPELAKHNNLYRAYYPPPDEPTRGLLPYIAFAGFETAFEEPKAEEGFKEVRMVNFHWEGSEEQRKKWDMYIE | ||||||||||||||||||
Expression Data
| Notation | Condition | Normalized Raw Expression |
|---|---|---|
| A | YPD 30°C, concentration: 2x 10^8 cells/ml | 2483 |
| B | YPD 30°C, concentration: 5x10^7 cells/ml | 3572 |
| C | YPD 30°C, fluconazole treatment, concentration: 5x10^7 cells/ml | 3306 |
| D | YPD 30°C, SDS 0.01% treatment, concentration: 5x10^7 cells/ml | 2998 |
| E | YPD 37°C, concentration: 5x10^7 cells/ml | 3116 |
| F | YP+galactose 30°C, concentration: 2x10^8 cells/ml | 2085 |