Phosphatase Browser
Detailed locus information, expression profile, gene disruption strategy, and phenotype assay data.
Detailed Locus Information for CNAG_04718T0
| Species | Cryptococcus neoformans var. grubii H99 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Gene Annotation | hypothetical protein | |||||||||
| Gene Symbol | PCD101 | |||||||||
| Phosphatase Name | N/A | |||||||||
| Phosphatase Class | Nucleoside-diphosphate-linked moiety X | |||||||||
| KEGG Linkout | KEGG::CNJ01490 | |||||||||
| Genome Browser | JBrowse link goes here. | |||||||||
| Protein Domain / KEGG Annotation |
|
|||||||||
| Amino Acid Sequence | MPPRTFTPSVLANISRALKPPSLPPIIPPHTQTTTSNRPPTDAAVLIPLMNINSEPHILMEVRANSMRVHAGEASFPGGKADDTDRDLIHTALREAHEELALPPSSVEILGMLDPEYSLGNRSRVWPFVGFIHSAPPPLSSAGSSLSSLPLSSLTLSSAEVSAILPLPLSALSDPRRRSIHLFRLNRFRPYYKIRADDLVIPLPGNEVNIPAHLEIWGLSGWLLNKFAEKVGWLDAPEIEKSPED | |||||||||
Expression Data
| Notation | Condition | Normalized Raw Expression |
|---|---|---|
| A | YPD 30°C, concentration: 2x 10^8 cells/ml | 1640 |
| B | YPD 30°C, concentration: 5x10^7 cells/ml | 1884 |
| C | YPD 30°C, fluconazole treatment, concentration: 5x10^7 cells/ml | 1932 |
| D | YPD 30°C, SDS 0.01% treatment, concentration: 5x10^7 cells/ml | 1473 |
| E | YPD 37°C, concentration: 5x10^7 cells/ml | 1562 |
| F | YP+galactose 30°C, concentration: 2x10^8 cells/ml | 1420 |
Gene Disruption Strategy
| Primer Name | Description | Primer Sequence |
|---|---|---|
| L1 | CNAG_04718 5' flanking region primer 1 | CGTCGTGGATAATGCCTTTC |
| L2 | CNAG_04718 5' flanking region primer 2 | TCACTGGCCGTCGTTTTACGAAGGAGTGAATGTCCGTG |
| R1 | CNAG_04718 3' flanking region primer 1 | CATGGTCATAGCTGTTTCCTGAAGTTGGATGGTTGGATGC |
| R2 | CNAG_04718 3' flanking region primer 2 | ACTCTTTCACTTTCACCCAC |
| SO | CNAG_04718 diagnostic screening primer, pairing with B79 | AAATACAAACGACCGAGGAC |
| PO | CNAG_04718 Southern blot probe primer | CTGGTGGTGGTTTGAGTATG |
| STM | NAT#146 STM primer | ACTAGCCCCCCCTCACCACCT |
| STM common | STM common primer | GCATGCCCTGCCCCTAAGAATTCG |
* Red marked sequences indicate the extended M13 forward and reversed sequences to overlap PCR with pNAT plasmid.
Phenotype Assays
| Growth | |
|---|---|
![]() | |
| Mating Data | |
![]() | |
| Virulence Factor Production | |
|
Capsule ![]() Urease ![]() Melanin ![]() | |
| Stress Response and Adaptation | |
|
Osmotic Stress ![]() Oxidative Stress ![]() Heavy Metal Stress ![]() Cell Wall Stress ![]() ER Stress ![]() Genotoxic Stress ![]() | |
| Antifungal Drug Susceptibility | |
![]() | |
| Virulence Data by the Insect Host Model (Galleria mellonella) | |
![]() | |
| Lung Infectivity Data by the Signature-tag Mutagenesis-based Murine Host Model | |
![]() |













